PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009601216.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 325aa    MW: 36383.9 Da    PI: 9.0844
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009601216.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.61.4e-54121391128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL +k+++ +++  ++i++vd++k+ePwdLp k+k + kewyfFs rd+ky+tg r+nrat++gyWk+tgkdke++s+
  XP_009601216.1  12 LPPGFRFHPTDEELITYYLVNKISDASFTG-RAIADVDLNKSEPWDLPGKAKMGGKEWYFFSLRDRKYPTGVRTNRATNTGYWKTTGKDKEIFSS 105
                     79*************************999.89***************999999***************************************98 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++elvg+kktLvfykgrap+gek++Wvmheyr+
  XP_009601216.1 106 kTSELVGMKKTLVFYKGRAPRGEKSNWVMHEYRI 139
                     67788***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-646161IPR003441NAC domain
PROSITE profilePS5100561.47512161IPR003441NAC domain
PfamPF023659.6E-2913139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MELEVNKEES SLPPGFRFHP TDEELITYYL VNKISDASFT GRAIADVDLN KSEPWDLPGK  60
AKMGGKEWYF FSLRDRKYPT GVRTNRATNT GYWKTTGKDK EIFSSKTSEL VGMKKTLVFY  120
KGRAPRGEKS NWVMHEYRIR SKSSYRTNKQ DEWVVCRIFQ KSAGLKKYPT NHSRTVVNPY  180
SLEINQNAIS SQIMMQPDHG FQFAMGRNYI NHASNYMNNF PIQQPQMNYN IGGSSSGGGG  240
GGGDNFFTIS GLNLNLGGGA AASSQPVLRP MPPPPPPPTQ VMNIQQEVMT SSMLDNCAIT  300
SEAGYGAEMN SANYCADLDN YWATY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-551116716171NO APICAL MERISTEM PROTEIN
1ut4_B2e-551116716171NO APICAL MERISTEM PROTEIN
1ut7_A2e-551116716171NO APICAL MERISTEM PROTEIN
1ut7_B2e-551116716171NO APICAL MERISTEM PROTEIN
3swm_A2e-551116719174NAC domain-containing protein 19
3swm_B2e-551116719174NAC domain-containing protein 19
3swm_C2e-551116719174NAC domain-containing protein 19
3swm_D2e-551116719174NAC domain-containing protein 19
3swp_A2e-551116719174NAC domain-containing protein 19
3swp_B2e-551116719174NAC domain-containing protein 19
3swp_C2e-551116719174NAC domain-containing protein 19
3swp_D2e-551116719174NAC domain-containing protein 19
4dul_A2e-551116716171NAC domain-containing protein 19
4dul_B2e-551116716171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF5102161e-137AF510216.1 Petunia x hybrida nam-like protein 19 (NH19) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009601216.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3-like
RefseqXP_016457772.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
TrEMBLA0A0M4FKX71e-146A0A0M4FKX7_MANES; NAC transcription factors 26
STRINGGLYMA04G08320.21e-143(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.21e-105NAC domain containing protein 38